PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_10482A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 631aa    MW: 69200.5 Da    PI: 4.52
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_10482AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.57.4e-143680348
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +W++eEd  l   ++++G+++W+ Ia+ +   +t+ qc+ rw++yl
  Oropetium_20150105_10482A 36 SWSAEEDAVLRSQIALHGTDNWTVIAAQFK-DKTARQCRRRWYNYL 80
                               6****************************9.**************7 PP

2Myb_DNA-binding42.61.4e-1386129146
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                +g W++eEd ll +a k lG++ W+ Ia+ +  gRt++ +k+r+ +
  Oropetium_20150105_10482A  86 KGGWSQEEDMLLCEAQKVLGNR-WTEIAKVVS-GRTDNAVKNRFST 129
                                688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.222984IPR017930Myb domain
SuperFamilySSF466891.72E-2633127IPR009057Homeodomain-like
SMARTSM007179.1E-133382IPR001005SANT/Myb domain
CDDcd001674.50E-133680No hitNo description
PfamPF139212.4E-153797No hitNo description
Gene3DG3DSA:1.10.10.604.9E-203787IPR009057Homeodomain-like
PROSITE profilePS5129416.95585135IPR017930Myb domain
SMARTSM007175.5E-1485133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-1988134IPR009057Homeodomain-like
CDDcd001674.62E-1089130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 631 aa     Download sequence    Send to blast
MATGPDLSSS SSSAAAAVPD AVPSAAAAKK DRHIVSWSAE EDAVLRSQIA LHGTDNWTVI  60
AAQFKDKTAR QCRRRWYNYL NSECKKGGWS QEEDMLLCEA QKVLGNRWTE IAKVVSGRTD  120
NAVKNRFSTL CKRRAKDEDP YPENVTSCSN ANAKRILTQI GCLTPGAAES SVPIKEIRSC  180
SSDLKENIVP NMRLFGQEKN TQDARQPLAI ISSSNKENVK IVETQNLSAK TATKQLIGGK  240
MNHESMSVAY TCISRVTDGS MSIISGMKRE GSFLNKSDPK VATLLQQADL LSSLAAKIKT  300
ENTSQSMDEA WEQLQHHLVK KDDREISESS MPGMASLLDE LDDLIVDPYE NNEEDEQKQR  360
EQNGCIDEHA EPCNSSSQSS KEVISHMASD EKMDNCPVVL IRENTTLCTN MLSQDMEPCP  420
GTEMTAPENL SEVVEDSMLL CMESTPPVVT DFDDLIVDPY ESKEEDEHKS RELSKQIDVH  480
DEHTNNPLQI NIELAPDTPP VLKIENCPVD NNCREDKSLC ISMLSGSMES CPGNLCKEYV  540
PASMNLSEVA EDSRLQGVEF TSPGHTVLHA KAGGFVSPKS GEVGKDSKLP SMEFTSPAYT  600
VPTFQPSEAD MPTPKFTASD ADLILVEVFG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-303713410107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958398.10.0PREDICTED: uncharacterized protein LOC101766438
TrEMBLK3ZRB20.0K3ZRB2_SETIT; Uncharacterized protein
STRINGSi029124m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP89033847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.23e-77MYB family protein